LAGE3 Polyclonal antibody

• 

LAGE3 Polyclonal Antibody for ELISA

Cat No. 18883-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

CVG5, DXS9879E, DXS9951E, ESO3, ITBA2, L antigen family member 3, L antigen family, member 3, LAGE3, Protein ESO 3, Protein ITBA2

---

Product Information

18883-1-AP targets LAGE3 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13441

  Product name: Recombinant human LAGE3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-143 aa of BC062330

  Sequence: MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVSR

• Full Name: L antigen family, member 3
• Calculated Molecular Weight: 143 aa, 15 kDa
• GenBank Accession Number: BC062330
• Gene Symbol: LAGE3
• Gene ID (NCBI): 8270
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14657
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.