LAMA2 Polyclonal antibody

• 

  WB analysis using 31181-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31181-1-AP (LAMA2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 31181-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 31181-1-AP (LAMA2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 31181-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 31181-1-AP (LAMA2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse skeletal muscle using 31181-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using LAMA2 antibody (31181-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

LAMA2 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 31181-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

LAMM, Laminin-4 subunit alpha, Laminin-2 subunit alpha, Laminin-12 subunit alpha, Laminin subunit alpha-2

---

Tested Applications

• Positive WB detected in: human placenta tissue, mouse skeletal muscle tissue, rat heart tissue
• Positive IHC detected in: mouse skeletal muscle tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31181-1-AP targets LAMA2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34494

  Product name: Recombinant human LAMA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2100-2250 aa of NM_000426

  Sequence: IDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGTISVRALDG

• Full Name: laminin, alpha 2
• Calculated Molecular Weight: 344 kDa
• Observed Molecular Weight: 344 kDa
• GenBank Accession Number: NM_000426
• Gene Symbol: LAMA2
• Gene ID (NCBI): 3908
• RRID: AB_3669885
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P24043
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The laminin subunit alpha 2 (LAMA2) gene encodes an alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Basal laminae are structural components of the extracellular matrix that influence cell proliferation and differentiation,7 and laminin subunit alpha 2 (LAMA2) is the major component of the basal laminae-α subunit of laminin. (PMID: 30728939)

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Diogo (Verified Customer) (10-23-2025)

I have tried several LAMA2 antibodies and this primary antibody worked very well with mouse skeletal muscle ,which allowed to progress on my PhD thesis.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Mouse Skeletal Muscle

LAMA2 Antibody Immunofluorescence validation (1:100 dilution) in Mouse Skeletal Muscle (Cat no:31181-1-AP)