CD107b / LAMP2 Polyclonal antibody

• 

  WB analysis using 27823-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27823-1-AP (LAMP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 27823-1-AP

  WB result of CD107b / LAMP2 antibody (27823-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CD107b / LAMP2 transfected HepG2 cells.

• 

  WB analysis of pig liver using 27823-1-AP

  pig liver tissue were subjected to SDS PAGE followed by western blot with 27823-1-AP (LAMP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 27823-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 27823-1-AP (LAMP2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 27823-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27823-1-AP (LAMP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 27823-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27823-1-AP (LAMP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 27823-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27823-1-AP (LAMP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 27823-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27823-1-AP (LAMP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

CD107b / LAMP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27823-1-AP

Publications(70)

Host / Isotype

Rabbit / IgG

Reactivity

human, pig and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

CD107b, LAMP2, CD107 antigen-like family member B, LAMP 2, LAMP-2

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cells, pig liver tissue, human placenta tissue
• Positive IHC detected in: human liver tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 50 publications below
• IHC: See 3 publications below
• IF: See 23 publications below

Product Information

27823-1-AP targets CD107b / LAMP2 in WB, IHC, IF, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Cited Reactivity: human, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27183

  Product name: Recombinant human LAMP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-230 aa of BC002965

  Sequence: LELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGND

• Full Name: lysosomal-associated membrane protein 2
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC002965
• Gene Symbol: LAMP2
• Gene ID (NCBI): 3920
• ENSEMBL Gene ID: ENSG00000005893
• RRID: AB_2880983
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13473
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lysosomal-associated membrane protein 2 (LAMP2, synonyms: LAMPB, CD107b) is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. LAMP2 may plays a role in tumor cell metastasis. It may also functions in the protection, maintenance, and adhesion of the lysosome. Prior to posttranslational modification, LAMP2 is a ~45 kDa polypeptide. Mature, functional LAMP2 is extensively glycosylated with a variety of different N linked and O linked oligosaccharides.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; 7-Dehydrocholesterol dictates ferroptosis sensitivity; Authors - Yaxu Li
human	WB	J Extracell Vesicles; Extracellular vesicle-mediated delivery of circDYM alleviates CUS-induced depressive-like behaviours.; Authors - Xiaoyu Yu
	WB	Autophagy; USP19 (ubiquitin specific peptidase 19) promotes TBK1 (TANK-binding kinase 1) degradation via chaperone-mediated autophagy.; Authors - Xibao Zhao
pig	IF	Autophagy; Extracellular vesicles originating from autophagy mediate an antibody-resistant spread of classical swine fever virus in cell culture; Authors - Tao Wang
human	WB	Oxid Med Cell Longev; Restoration of Autophagic Flux Rescues Oxidative Damage and Mitochondrial Dysfunction to Protect against Intervertebral Disc Degeneration.; Authors - Liang Kang
pig	WB	J Anim Sci Biotechnol; Glyphosate exposure deteriorates oocyte meiotic maturation via induction of organelle dysfunctions in pigs.; Authors - Chunhua Xing