LAMTOR4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LAMTOR4 Polyclonal antibody, PBS Only (32958-1-PBS)

• 

  WB analysis using 32958-1-AP (same clone as 32958-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32958-1-AP (LAMTOR4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32958-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 32958-1-AP (same clone as 32958-1-PBS)

  IP result of anti-LAMTOR4 (IP:32958-1-AP, 4ug; Detection:32958-1-AP 1:1000) with HeLa cells lysate 1600 ug. This data was developed using the same antibody clone with 32958-1-PBS in a different storage buffer formulation.

LAMTOR4 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 32958-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

C7orf59, Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4, Ragulator complex protein LAMTOR4, Ragulator complex protein LAMTOR4, N-terminally processed

---

Product Information

32958-1-PBS targets LAMTOR4 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39105

  Product name: Recombinant human C7orf59 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of BC130553

  Sequence: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV

• Full Name: chromosome 7 open reading frame 59
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC130553
• Gene Symbol: C7orf59
• Gene ID (NCBI): 389541
• RRID: AB_3742805
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q0VGL1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4 (LAMTOR4) is a protein belonging to the LAMTOR family and believed to be involved in cell cycle, proliferation, and growth (PMID: 29138253). LAMTOR4 has been reported as a regulator complex that acts as an activator of rapamycin complex 1 (mTORC1) by sensing changes in the levels of amino acids (PMID: 33429026). It might offer a strategy to inhibit tumor progression and metastasis in prostate cancer (PMID: 39125671).