LANCL1 Monoclonal antibody

• 

  WB analysis using 68160-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68160-1-Ig (LANCL1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of HeLa using 68160-1-Ig

  WB result of LANCL1 antibody (68160-1-Ig; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LANCL1 transfected HeLa cells.

• 

  IP experiment of mouse brain using 68160-1-Ig

  IP result of anti-LANCL1 (IP:68160-1-Ig, 5ug; Detection:68160-1-Ig 1:2000) with mouse brain tissue lysate 1600 ug.

• 

  IF Staining of U-251 using 68160-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using LANCL1 antibody (68160-1-Ig, Clone: 2H6E8 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

LANCL1 Monoclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 68160-1-Ig

Clone No.2H6E8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, IP, ELISA

Synonyms

2H6E8, EC:2.5.1.18, Glutathione S-transferase LANCL1, GPR69A, LanC like protein 1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68160-1-Ig targets LANCL1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32665

  Product name: Recombinant human LANCL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 100-399 aa of BC028685

  Sequence: TKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL

• Full Name: LanC lantibiotic synthetase component C-like 1 (bacterial)
• Calculated Molecular Weight: 399 aa, 45 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC028685
• Gene Symbol: LANCL1
• Gene ID (NCBI): 10314
• RRID: AB_2923679
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43813
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LanCL1 ( also known as P40 or GRP69A), is homologous to bacterial lanthionine synthetase C (LanC) family, which is involved in the biosynthesis of antimicrobial peptides (lantibiotics). LanCL1 was identified as a reduced glutathione (GSH)-binding protein and primarily expressed in neural tissues and testis.