LANCL2 Polyclonal antibody

• 

  WB analysis using 33580-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33580-1-AP (LANCL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

LANCL2 Polyclonal Antibody for WB, ELISA

Cat No. 33580-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

GPR69B, LanC-like protein 2, TASP, Testis-specific adriamycin sensitivity protein

---

Tested Applications

• Positive WB detected in: A431 cells, mouse brain tissue, mouse testis tissue, rat brain tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33580-1-AP targets LANCL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38046

  Product name: Recombinant human LANCL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-323 aa of BC070049

  Sequence: MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATPDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHG

• Full Name: LanC lantibiotic synthetase component C-like 2 (bacterial)
• Calculated Molecular Weight: 450 aa, 51 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC070049
• Gene Symbol: LANCL2
• Gene ID (NCBI): 55915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NS86
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LanCL2 is a major male germ cell-specific antioxidant gene that is important for testicular homeostasis. Highly expressed in the brain and testis, LanCL2 expression correlates with testicular maturation and brain development. LanCL2 is enriched in spermatocytes and round spermatids of the testis (PMID: 38790639).