LAPTM4A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LAPTM4A Polyclonal antibody, PBS Only (30627-1-PBS)

• 

  WB analysis using 30627-1-AP (same clone as 30627-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30627-1-AP (LAPTM4A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30627-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 30627-1-AP (same clone as 30627-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using LAPTM4A antibody (30627-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30627-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 30627-1-AP (same clone as 30627-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using LAPTM4A antibody (30627-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30627-1-PBS in a different storage buffer formulation.

LAPTM4A Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 30627-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Synonyms

Golgi 4-transmembrane-spanning transporter MTP, HUMORF13, KIAA0108, LAPTM4, Lysosomal-associated transmembrane protein 4A

---

Product Information

30627-1-PBS targets LAPTM4A in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6501

  Product name: Recombinant human LAPTM4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-233 aa of BC000421

  Sequence: MVSMSFKRNRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAVNIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDFVLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLINCVWNCYKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA

• Full Name: lysosomal protein transmembrane 4 alpha
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC000421
• Gene Symbol: LAPTM4A
• Gene ID (NCBI): 9741
• RRID: AB_3086376
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15012
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LAPTM4A is an intracellular membrane protein that regulates the function of organic cation transporter-2 (OCT2) through direct interaction. LAPTM4A can also form a complex with A4GALT in the Golgi and shows at about 70 kDa.