Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human breast cancer tissue, human placenta tissue, human testis tissue, human skin tissue, human liver tissue, human spleen tissue, human stomach cancer tissue, human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17067-1-AP targets LARP7 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10891 Product name: Recombinant human LARP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 83-331 aa of BC006981 Sequence: LTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPALRVVEEKKKKKKKKGRMKKEDNIQAKEENMDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRDRVEASSLPEVRTGKRKRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKE Predict reactive species |
| Full Name | La ribonucleoprotein domain family, member 7 |
| Calculated Molecular Weight | 582 aa, 67 kDa |
| Observed Molecular Weight | 67 kDa |
| GenBank Accession Number | BC006981 |
| Gene Symbol | LARP7 |
| Gene ID (NCBI) | 51574 |
| RRID | AB_2132693 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q4G0J3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LARP7 belongs to the LARP RNA-binding protein family, which includes the lupus LA antigen gene, and modulates the metabolism and function of a variety of RNA species [PMID:20138158]. LARP7 binds to the 7SK RNP complex, and sequesters the positive transcription elongation factor b (P-TEFb) in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation. binds to and stabilizes 7sk snRNA[PMID:19416841].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LARP7 antibody 17067-1-AP | Download protocol |
| IHC protocol for LARP7 antibody 17067-1-AP | Download protocol |
| WB protocol for LARP7 antibody 17067-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LARP7 antibody (Cat# 17067-1-AP) has 16 citations. These appear in journals including Nature Communications, Molecular Cell, Nucleic Acids Research, Cell Death & Disease, Genes & Development, EMBO Reports, mBio, Scientific Reports, Translational Oncology, Stem Cells, RNA Biology, American Journal of Cancer Research, and Human Mutation. Research fields span RNA biology and transcription regulation (7SK snRNP, m6A modification), cancer (colorectal, lung, GIST), neurodevelopmental disorders, stem cell biology, and HIV/Legionella infection.
| Species | Application | Title |
|---|---|---|
Nat Commun Pseudouridylation of 7SK by PUS7 regulates Pol II transcription elongation.
| ||
Nat Commun Interaction of 7SK with the Smn complex modulates snRNP production.
| ||
Mol Cell N6-methyladenosine in 7SK small nuclear RNA underlies RNA polymerase II transcription regulation | ||
Nucleic Acids Res HMGA1 recruits CTIP2-repressed P-TEFb to the HIV-1 and cellular target promoters. | ||
Nucleic Acids Res 7SK small nuclear RNA directly affects HMGA1 function in transcription regulation. | ||
Cell Death Dis ILF3 promotes colorectal cancer cell resistance to ferroptosis by enhancing cysteine uptake and GSH synthesis via stabilizing SLC3A2 mRNA. |
Reviews
What customers say
Customers report this antibody performs well in Western Blot, producing a specific band. One user noted some background, likely due to low dilution and overnight incubation, but still rated it a fair product. Another user confirmed strong performance at 1:1000–1:2000 dilutions in lung carcinoma and Calu-3 cells, and validated specificity using LARP7 knock-out cell lines. Overall, reviewers find it reliable for WB with good specificity at appropriate dilutions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Yaroslav (Verified Customer) (07-14-2026) | These antibodies give a specific band together with some background, which in my case could be a consequence of relatively low dilution and overnight incubation. Overall, it is a fair product.
 |
Monika (Verified Customer) (10-09-2023) | Great antibody, successfully used in western blots with 1:1000 to 1:2000 dilutions. Verified using a Calu-3 and HEK293T LARP7 knock-out cell lines.
 |
