LARP7 Recombinant monoclonal antibody

• 

  WB analysis using 84950-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84950-3-RR (LARP7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 84950-3-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84950-3-RR (LARP7 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 84950-3-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84950-3-RR (LARP7 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 84950-3-RR

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using LARP7 antibody (84950-3-RR, Clone: 242561F5 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

LARP7 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 84950-3-RR

Clone No.242561F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

242561F5, HDCMA18P, hLARP7, La related protein 7, La-related protein 7

---

Tested Applications

• Positive WB detected in: LNCaP cells, HEK-293 cells, HeLa cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84950-3-RR targets LARP7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10850

  Product name: Recombinant human LARP7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 83-331 aa of BC006981

  Sequence: LTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPALRVVEEKKKKKKKKGRMKKEDNIQAKEENMDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRDRVEASSLPEVRTGKRKRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKE

• Full Name: La ribonucleoprotein domain family, member 7
• Calculated Molecular Weight: 582 aa, 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC006981
• Gene Symbol: LARP7
• Gene ID (NCBI): 51574
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q4G0J3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LARP7 belongs to the LARP RNA-binding protein family, which includes the lupus LA antigen gene, and modulates the metabolism and function of a variety of RNA species [PMID:20138158]. LARP7 binds to the 7SK RNP complex, and sequesters the positive transcription elongation factor b (P-TEFb) in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.[PMID:19416841].