LARP7 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84950-4-RR (same clone as 84950-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84950-4-RR (LARP7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84950-4-PBS in a different storage buffer formulation.

LARP7 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84950-4-PBS

Clone No.242561C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

PIP7S, La-related protein 7, La related protein 7, hLARP7, HDCMA18P

---

Product Information

84950-4-PBS targets LARP7 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10850

  Product name: Recombinant human LARP7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 83-331 aa of BC006981

  Sequence: LTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPALRVVEEKKKKKKKKGRMKKEDNIQAKEENMDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRDRVEASSLPEVRTGKRKRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKE

• Full Name: La ribonucleoprotein domain family, member 7
• Calculated Molecular Weight: 582 aa, 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC006981
• Gene Symbol: LARP7
• Gene ID (NCBI): 51574
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q4G0J3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LARP7 belongs to the LARP RNA-binding protein family, which includes the lupus LA antigen gene, and modulates the metabolism and function of a variety of RNA species [PMID:20138158]. LARP7 binds to the 7SK RNP complex, and sequesters the positive transcription elongation factor b (P-TEFb) in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.[PMID:19416841].