LASP1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82491-1-RR (same clone as 82491-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82491-1-RR (LASP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 82491-1-RR (same clone as 82491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 82491-1-RR (LASP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 82491-1-RR (same clone as 82491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 82491-1-RR (LASP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82491-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 82491-1-RR (same clone as 82491-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using LASP1 antibody (82491-1-RR, Clone: 4J2 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 82491-1-PBS in a different storage buffer formulation.

LASP1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 82491-1-PBS

Clone No.4J2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

4J2, LASP-1, LIM and SH3 protein 1, MLN50

---

Product Information

82491-1-PBS targets LASP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0800

  Product name: Recombinant human LASP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 125-210 aa of BC012460

  Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA

• Full Name: LIM and SH3 protein 1
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC012460
• Gene Symbol: LASP1
• Gene ID (NCBI): 3927
• ENSEMBL Gene ID: ENSG00000002834
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14847
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604).