Product Information
84514-4-PBS targets LASS2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14151 Product name: Recombinant human LASS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 315-380 aa of BC010032 Sequence: LHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKND Predict reactive species |
| Full Name | LAG1 homolog, ceramide synthase 2 |
| Calculated Molecular Weight | 380 aa, 45 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC010032 |
| Gene Symbol | LASS2 |
| Gene ID (NCBI) | 29956 |
| RRID | AB_3672021 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q96G23 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
LASS2, also known as TMSG1, is a novel suppressor of human cancer metastasis. As one member of LASS family, including LASS1-6, LASS2 mRNA is at the highest level of all LASS members, and has the broadest tissue distribution, particularly abundant in the liver, kidney and brain in mice. The biological roles of LASS2 include protection from aging , hepatic INS resistance, and hepatocellular carcinoma (HCC) progression. LASS2 has been correlated with the degree of invasion and recurrence of carcinomas of the prostate, liver, breast and bladder.







