LATS1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• LATS1 Recombinant monoclonal antibody (80613-2-RR)

LATS1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 80613-2-RR

Clone No.252021E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EC:2.7.11.1, h-warts, LATS 1, Serine/threonine-protein kinase LATS1, WARTS

• 

  WB analysis using 80613-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 80613-2-RR (LATS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HepG2 cells, HT-29 cells, A549 cells, NIH/3T3 cells, C2C12 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

80613-2-RR targets LATS1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11140

  Product name: Recombinant human LATS1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-135 aa of BC015665

  Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI

• Full Name: LATS, large tumor suppressor, homolog 1 (Drosophila)
• Calculated Molecular Weight: 15 kDa, 127 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC015665
• Gene Symbol: LATS1
• Gene ID (NCBI): 9113
• RRID: AB_3743348
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6PJG3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongs to the AGC Ser/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268).