LAX1 Polyclonal antibody

• 

  WB analysis using 21557-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21557-1-AP (LAX1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 21557-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21557-1-AP (LAX1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 21557-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21557-1-AP (LAX1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human spleen using 21557-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 21557-1-AP (LAX1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human spleen using 21557-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 21557-1-AP (LAX1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HeLa using 21557-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 21557-1-AP (LAX1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

LAX1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21557-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

LAX, LAX1

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

21557-1-AP targets LAX1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15599

  Product name: Recombinant human LAX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-322 aa of BC069650

  Sequence: MPLLTLPQTRQRAKNIYDILPWRQEDLGRHESRSMRIFSTESLLSRNSESPEHVPSQAGNAFQEHTAHIHATEYAVGIYDNAMVPQMCGNLTPSAHCINVRASRDCASISSEDSHDYVNVPTAEEIAETLASTKSPSRNLFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQERQLWVAFQCCRDYENVPAADPSGSQQQAEKDVPSSNIGHVEDKTDDPGTHVQCVKRTFLASGDYADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLLPDE

• Full Name: lymphocyte transmembrane adaptor 1
• Calculated Molecular Weight: 398 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC069650
• Gene Symbol: LAX1
• Gene ID (NCBI): 54900
• RRID: AB_10732821
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWV1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Immunol; Mettl14-Mediated m6A Modification Is Essential for Germinal Center B Cell Response.; Authors - Hengjun Huang
human	WB	Cell Rep Med; A target discovery pipeline identified ILT3 as a target for immunotherapy of multiple myeloma; Authors - Francesco Di Meo