LAX1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LAX1 Polyclonal antibody (21557-1-AP)

LAX1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21557-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

LAX, LAX1

• 

  WB analysis using 21557-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21557-1-AP (LAX1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 21557-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21557-1-AP (LAX1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 21557-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21557-1-AP (LAX1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 21557-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 21557-1-AP (LAX1 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 21557-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 21557-1-AP (LAX1 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 21557-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 21557-1-AP (LAX1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LAX1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21557-1-AP targets LAX1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15599

  Product name: Recombinant human LAX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-322 aa of BC069650

  Sequence: MPLLTLPQTRQRAKNIYDILPWRQEDLGRHESRSMRIFSTESLLSRNSESPEHVPSQAGNAFQEHTAHIHATEYAVGIYDNAMVPQMCGNLTPSAHCINVRASRDCASISSEDSHDYVNVPTAEEIAETLASTKSPSRNLFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQERQLWVAFQCCRDYENVPAADPSGSQQQAEKDVPSSNIGHVEDKTDDPGTHVQCVKRTFLASGDYADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLLPDE

• Full Name: lymphocyte transmembrane adaptor 1
• Calculated Molecular Weight: 398 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC069650
• Gene Symbol: LAX1
• Gene ID (NCBI): 54900
• RRID: AB_10732821
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWV1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The LAX1 Polyclonal antibody (Cat# 21557-1-AP) has 3 total citations. These appear in Cell Reports in Medicine, BMC Geriatrics, and Journal of Immunology. The associated research fields include immunotherapy for multiple myeloma, Alzheimer's disease and periodontitis biomarker research, and m6A RNA modification in germinal center B cell responses. All three citations used the antibody for Western blot (WB) applications in human or mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep Med; A target discovery pipeline identified ILT3 as a target for immunotherapy of multiple myeloma; Authors - Francesco Di Meo
mouse	WB	BMC Geriatr; LAX1 as a core biomarker in Alzheimer's disease and periodontitis via the STAT signaling pathway.; Authors - Han Guo ; KD Validated
mouse	WB	J Immunol; Mettl14-Mediated m6A Modification Is Essential for Germinal Center B Cell Response.; Authors - Hengjun Huang