LC8/DYNLL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LC8/DYNLL1 Polyclonal antibody, PBS Only (18130-1-PBS)

• 

  WB analysis using 18130-1-AP (same clone as 18130-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18130-1-AP (LC8/DYNLL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18130-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 18130-1-AP (same clone as 18130-1-PBS)

  IP result of anti-LC8/DYNLL1 (IP:18130-1-AP, 4ug; Detection:18130-1-AP 1:1000) with MCF-7 cells lysate 640 ug. This data was developed using the same antibody clone with 18130-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18130-1-AP (same clone as 18130-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18130-1-AP (LC8/DYNLL1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18130-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 18130-1-AP (same clone as 18130-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18130-1-AP (LC8/DYNLL1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18130-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 18130-1-AP (same clone as 18130-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18130-1-AP (LC8/DYNLL1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18130-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18130-1-AP (same clone as 18130-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18130-1-AP (LC8/DYNLL1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18130-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 18130-1-AP (same clone as 18130-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using LC8/DYNLL1 antibody (18130-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 18130-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 18130-1-AP (same clone as 18130-1-PBS)

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human LC8/DYNLL1 (18130-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug x. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 18130-1-PBS in a different storage buffer formulation.

LC8/DYNLL1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 18130-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

---

Product Information

18130-1-PBS targets LC8/DYNLL1 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12710

  Product name: Recombinant human LC8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-89 aa of BC100289

  Sequence: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

• Full Name: dynein, light chain, LC8-type 1
• Calculated Molecular Weight: 89 aa, 10 kDa
• Observed Molecular Weight: 8-10 kDa
• GenBank Accession Number: BC100289
• Gene Symbol: DYNLL1
• Gene ID (NCBI): 8655
• RRID: AB_2923569
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63167
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LC8 (also known as DYNLL1) is a homodimeric sequence-specific chaperone that promotes the ordered (typically homo-) oligomerization of more than a hundred protein targets. LC8/DYNLL1 has previously been proposed to function as an inhibitor of the NF-κB pathway, based on findings that it can bind directly to the IκBα regulatory region(PMID: 18579519). LC8/DYNLL1 regulates apoptotic activities of BCL2L11 by sequestering it to microtubules.