Filter: AllIHC

IHC staining of human skin using 26512-1-AP (same clone as 26512-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 26512-1-AP (LCE2B Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 26512-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 26512-1-AP (same clone as 26512-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 26512-1-AP (LCE2B Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 26512-1-PBS in a different storage buffer formulation.

LCE2B Polyclonal antibody, PBS Only

Name: LCE2B Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 26512-1-PBS

LCE2B Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 26512-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

26512-1-PBS targets LCE2B in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag20213 Product name: Recombinant human LCE2B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-70 aa of BC117235 Sequence: MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSSGGCCNSGAGG Predict reactive species
Full Name	late cornified envelope 2B
Calculated Molecular Weight	110 aa, 11 kDa
GenBank Accession Number	BC117235
Gene Symbol	LCE2B
Gene ID (NCBI)	26239
RRID	AB_2880537
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O14633
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

This protein is skin-specific.

Able™