LCMT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LCMT1 Polyclonal antibody, PBS Only (30222-1-PBS)

• 

  WB analysis using 30222-1-AP (same clone as 30222-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30222-1-AP (LCMT1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30222-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse uterus using 30222-1-AP (same clone as 30222-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse uterus tissue slide using 30222-1-AP (LCMT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30222-1-PBS in a different storage buffer formulation.

LCMT1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30222-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

30222-1-PBS targets LCMT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32038

  Product name: Recombinant human LCMT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 179-299 aa of BC001214

  Sequence: EEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMELYNRLPRAEVSRIESL

• Full Name: leucine carboxyl methyltransferase 1
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38-41 kDa
• GenBank Accession Number: BC001214
• Gene Symbol: LCMT1
• Gene ID (NCBI): 51451
• RRID: AB_2935534
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UIC8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Leucine carboxyl methyltransferase 1 (LCMT1) belongs to the methyltransferase superfamily (LCMT family). It methylates the carboxyl group of the C-terminal leucine residue of protein phosphatase 2A catalytic subunits to form alpha-leucine ester residues. LCMT1 has 3 isoforms with the MW of 38 kDa, 41 kDa, and 32 kDa.