LCN1 Polyclonal antibody

• 

  WB analysis of human saliva using 17900-1-AP

  human saliva were subjected to SDS PAGE followed by western blot with 17900-1-AP (LCN1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Transfected HEK-293 using 17900-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 17900-1-AP (LCN1 Antibody) at dilution of 1:1000 incubated at 4 degree celsius over night.

LCN1 Polyclonal Antibody for WB, ELISA

Cat No. 17900-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

LCN1, Lipocalin 1, lipocalin 1 (tear prealbumin), PMFA, Tear lipocalin, Tear prealbumin, Tlc, TP, VEG protein, VEGP, Von Ebner gland protein

---

Tested Applications

• Positive WB detected in: human saliva tissue, Transfected HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17900-1-AP targets LCN1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12270

  Product name: Recombinant human LCN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC074925

  Sequence: MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

• Full Name: lipocalin 1 (tear prealbumin)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 17-19 kDa
• GenBank Accession Number: BC074925
• Gene Symbol: LCN1
• Gene ID (NCBI): 3933
• RRID: AB_2878462
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31025
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Biosensors (Basel); Colorimetric Diagnostic Capillary Enabled by Size Sieving in a Porous Hydrogel.; Authors - John Mello Camille C Guzman