LCN12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LCN12 Polyclonal antibody, PBS Only (28004-1-PBS)

• 

  WB analysis using 28004-1-AP (same clone as 28004-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28004-1-AP (LCN12 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28004-1-PBS in a different storage buffer formulation.

LCN12 Polyclonal Antibody for WB, ELISA

Cat No. 28004-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

lipocalin 12

---

Product Information

28004-1-PBS targets LCN12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27402

  Product name: Recombinant human LCN12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 51-177 aa of BC041168

  Sequence: NSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTLDQFICLGRAQGLSDDNI

• Full Name: lipocalin 12
• Calculated Molecular Weight: 355 aa, 37 kDa
• Observed Molecular Weight: 20-22 kDa
• GenBank Accession Number: BC041168
• Gene Symbol: LCN12
• Gene ID (NCBI): 286256
• RRID: AB_3742271
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6JVE5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LCN12 (Lipocalin 12) is an epididymis-specific protein that might play a significant physiological role in male reproduction (PMID: 20692383).