• Featured Product
  • KD/KO Validated

Lipocalin-2/NGAL Polyclonal antibody

Lipocalin-2/NGAL Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 26991-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

LCN2, lipocalin 2, NGAL, 24p3, 25 kDa alpha-2-microglobulin-related subunit of MMP-9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, human saliva
Positive IHC detected inhuman colon cancer tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26991-1-AP targets Lipocalin-2/NGAL in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25715

Product name: Recombinant human LCN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 46-198 aa of

Sequence: MQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

Predict reactive species
Full Name lipocalin 2
Observed Molecular Weight 25 kDa
Gene Symbol NGAL/LCN2
Gene ID (NCBI) 3934
RRIDAB_2880715
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP80188
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lipocalin-2 (LCN-2) is a adipocytokine also referred to as neutrophil gelatinase-associated lipocalin (NGAL). Lipocalin-2 is a circulatory protein responsible for the transportation of small and hydrophobic molecules to target organs. Lipocalin-2 is used as a biomarker for acute and chronic renal injury. It is present in a large variety of cells including neutrophil, hepatocytes, lung, bone marrow, adipose tissue, macrophages, thymus, non-neoplastic breast duct, prostate, and renal cells. Different functions have been associated with Lipocalin-2, including antibacterial, anti-inflammatory, and protection against cell and tissue stress (PMID:34463264).

Protocols

Product Specific Protocols
FC protocol for Lipocalin-2/NGAL antibody 26991-1-APDownload protocol
IF protocol for Lipocalin-2/NGAL antibody 26991-1-APDownload protocol
IHC protocol for Lipocalin-2/NGAL antibody 26991-1-APDownload protocol
WB protocol for Lipocalin-2/NGAL antibody 26991-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Neurol Neurosurg Psychiatry

Molecules of senescent glial cells differentiate Alzheimer's disease from ageing

Authors - Linbin Dai
WB

Cell Chem Biol

3D two-photon brain imaging reveals dihydroartemisinin exerts antiepileptic effects by modulating iron homeostasis.

Authors - Chenwen Shao
humanWB

Oxid Med Cell Longev

Sirtuin 1 Induces Choroidal Neovascularization and Triggers Age-Related Macular Degeneration by Promoting LCN2 through SOX9 Deacetylation.

Authors - Su Zhao
  • KD Validated
humanWB,IHC

Gastric Cancer

Lipocalin-2 negatively regulates epithelial-mesenchymal transition through matrix metalloprotease-2 downregulation in gastric cancer.

Authors - Sadaaki Nishimura
  • KD Validated
humanWB,IHC

Biochim Biophys Acta Mol Basis Dis

Lipocalin-2-mediated intestinal epithelial cells pyroptosis via NF-κB/NLRP3/GSDMD signaling axis adversely affects inflammation in colitis

Authors - Yuyi Yang
humanIF

iScience

Mutational burden of XPNPEP3 leads to defects in mitochondrial complex I and cilia in NPHPL1

Authors - Lingxiao Tong
Loading...
||
New chat Able
正在加载,请稍候...