Lipocalin-2/NGAL Polyclonal antibody

• 

• Featured Product
• KD/KO Validated

Lipocalin-2/NGAL Polyclonal Antibody for ELISA

Cat No. 26991-1-AP

Publications(50)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

LCN2, lipocalin 2, NGAL, 24p3, 25 kDa alpha-2-microglobulin-related subunit of MMP-9

---

Published Applications

• KD/KO: See 3 publications below
• WB: See 35 publications below
• IHC: See 14 publications below
• IF: See 9 publications below

Product Information

26991-1-AP targets Lipocalin-2/NGAL in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25715

  Product name: Recombinant human LCN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 46-198 aa of

  Sequence: MQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

• Full Name: lipocalin 2
• Observed Molecular Weight: 25 kDa
• Gene Symbol: NGAL/LCN2
• Gene ID (NCBI): 3934
• RRID: AB_2880715
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P80188
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lipocalin-2 (LCN-2) is a adipocytokine also referred to as neutrophil gelatinase-associated lipocalin (NGAL). Lipocalin-2 is a circulatory protein responsible for the transportation of small and hydrophobic molecules to target organs. Lipocalin-2 is used as a biomarker for acute and chronic renal injury. It is present in a large variety of cells including neutrophil, hepatocytes, lung, bone marrow, adipose tissue, macrophages, thymus, non-neoplastic breast duct, prostate, and renal cells. Different functions have been associated with Lipocalin-2, including antibacterial, anti-inflammatory, and protection against cell and tissue stress (PMID:34463264).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Neurol Neurosurg Psychiatry; Molecules of senescent glial cells differentiate Alzheimer's disease from ageing; Authors - Linbin Dai
	WB	Cell Chem Biol; 3D two-photon brain imaging reveals dihydroartemisinin exerts antiepileptic effects by modulating iron homeostasis.; Authors - Chenwen Shao
human	WB	Oxid Med Cell Longev; Sirtuin 1 Induces Choroidal Neovascularization and Triggers Age-Related Macular Degeneration by Promoting LCN2 through SOX9 Deacetylation.; Authors - Su Zhao ; KD Validated
human	WB,IHC	Gastric Cancer; Lipocalin-2 negatively regulates epithelial-mesenchymal transition through matrix metalloprotease-2 downregulation in gastric cancer.; Authors - Sadaaki Nishimura ; KD Validated
human	WB,IHC	Biochim Biophys Acta Mol Basis Dis; Lipocalin-2-mediated intestinal epithelial cells pyroptosis via NF-κB/NLRP3/GSDMD signaling axis adversely affects inflammation in colitis; Authors - Yuyi Yang
human	WB	iScience; IRP1 mediated ferroptosis reverses temozolomide resistance in glioblastoma via affecting LCN2/FPN1 signaling axis depended on NFKB2; Authors - Yufei Lan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

MALLIKARJUNA (Verified Customer) (11-26-2025)

good for wb

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: liver tissue