Lipocalin-2/NGAL Polyclonal antibody

• 

• Featured Product
• KD/KO Validated

Lipocalin-2/NGAL Polyclonal Antibody for ELISA

Cat No. 30700-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

LCN2, lipocalin 2, NGAL, 24p3, 25 kDa alpha-2-microglobulin-related subunit of MMP-9

---

Published Applications

• WB: See 1 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

30700-1-AP targets Lipocalin-2/NGAL in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33369

  Product name: Recombinant human LCN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 46-198 aa of

  Sequence: QFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

• Full Name: lipocalin 2
• Observed Molecular Weight: 22-25 kDa
• Gene Symbol: NGAL/LCN2
• Gene ID (NCBI): 3934
• RRID: AB_3086393
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P80188
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lipocalin-2 (LCN-2) is a adipocytokine also referred to as neutrophil gelatinase-associated lipocalin (NGAL). Lipocalin-2 is a circulatory protein responsible for the transportation of small and hydrophobic molecules to target organs. Lipocalin-2 is used as a biomarker for acute and chronic renal injury. It is present in a large variety of cells including neutrophil, hepatocytes, lung, bone marrow, adipose tissue, macrophages, thymus, non-neoplastic breast duct, prostate, and renal cells. Different functions have been associated with Lipocalin-2, including antibacterial, anti-inflammatory, and protection against cell and tissue stress (PMID:34463264).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Redox Biol; Protective role of vitamin D receptor against mitochondrial calcium overload from PM2.5-Induced injury in renal tubular cells; Authors - Mengqiu Lu
	IF	Front Bioeng Biotechnol; Ultra-small curcumin-ruthenium coordination polymer nanodots prevent renal ischemia-reperfusion injury and the progression to chronic kidney disease; Authors - Xian Liu
	WB	Adv Sci (Weinh); Adaptive Antioxidant Nanomedicines Inhibit Ferroptosis in Renal Tubular Epithelial Cells to Alleviate Diabetic Kidney Disease; Authors - Zerun Liu
	IHC	Front Mol Biosci; S100A8/A9 high-expression macrophages mediate renal tubular epithelial cell damage in acute kidney injury following acute type A aortic dissection surgery; Authors - Xiujuan Cai