LCN6 Polyclonal antibody

• 

LCN6 Polyclonal Antibody for ELISA

Cat No. 11923-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

hLcn5, LCN5, LCN6, Lipocalin 5, lipocalin 6, UNQ643

---

Product Information

11923-1-AP targets LCN6 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2570

  Product name: Recombinant human LCN6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-163 aa of BC062746

  Sequence: MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLRTLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSRSLGFLSQ

• Full Name: lipocalin 6
• Calculated Molecular Weight: 163 aa, 18 kDa
• GenBank Accession Number: BC062746
• Gene Symbol: LCN6
• Gene ID (NCBI): 158062
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62502
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.