L-Plastin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• L-Plastin Polyclonal antibody (13025-1-AP)

• Featured Product
• KD/KO Validated

L-Plastin Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13025-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

LCP1, L PLASTIN, LCP 1, LCP-1, LPL

• 

  WB analysis of Jurkat using 13025-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13025-1-AP (L-Plastin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13025-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13025-1-AP (L-Plastin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 13025-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13025-1-AP (L-Plastin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse spleen using 13025-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 13025-1-AP (L-Plastin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 13025-1-AP

  IP result of anti-L-Plastin (IP:13025-1-AP, 4ug; Detection:13025-1-AP 1:1000) with Jurkat cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 13025-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 13025-1-AP (L-Plastin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for L-Plastin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, mouse spleen tissue, RAW 264.7 cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13025-1-AP targets L-Plastin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, monkey, zebrafish, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3571

  Product name: Recombinant human LCP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 278-627 aa of BC010271

  Sequence: LENAGCNKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAEKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV

• Full Name: lymphocyte cytosolic protein 1 (L-plastin)
• Calculated Molecular Weight: 627 aa, 64 kDa
• Observed Molecular Weight: 64-70 kDa
• GenBank Accession Number: BC010271
• Gene Symbol: L-Plastin
• Gene ID (NCBI): 3936
• RRID: AB_2136871
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13796
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LCP1, also known as L-Plastin, is a member of the Plastin gene family. The family members include L-Plastin (LCP1), T-Plastin (PLS3), and I-Plastin (PLS1), which can regulate the dynamic reorganization of the cytoskeleton by binding and cross-linking actin filaments. In lymphocytes, LCP1 can regulate immune responses, especially during inflammation and infection. It acts as a key regulator of T-cell activation by responding to co-stimulatory signals through TCR/CD3 and CD2 or CD28, and regulates the cell-surface expression of IL2RA/CD25 and CD69 (PMID: 17294403).

Publications

What published studies show

The anti-LCP1 antibody (Cat# 13025-1-AP) has 14 citations spanning journals including Science Signaling, Cancer Cell International, Molecular Therapy Nucleic Acids, Respiratory Research, Cell Signaling, Journal of Cell Science, and BMC Immunology. Research fields cover oncology (oral, ovarian, gastric, breast, and osteosarcoma cancers), lipid metabolism, pulmonary hypertension, neonatal hypoxic-ischemic brain injury, retinal cell biology, and hepatic steatosis. Applications include WB, IHC, IF, and IP across human, mouse, zebrafish, monkey, and hamster species.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Signal; A hepatokine derived from the ER protein CREBH promotes triglyceride metabolism by stimulating lipoprotein lipase activity; Authors - Hyunbae Kim
human	WB	Cancer Cell Int; LCP1 upregulation via EGFR signaling promotes oral cancer progression through the JAK2/STAT3/IL-1β axis.; Authors - Chiao-Rou Liu ; KD Validated
human	WB,IHC	Mol Ther Nucleic Acids; Exosomal Transfer of LCP1 Promotes Osteosarcoma Cell Tumorigenesis and Metastasis by Activating the JAK2/STAT3 Signaling Pathway.; Authors - Xuhui Ge
human	WB	Respir Res; Comprehensive profiling of lactylation-associated genes in pulmonary hypertension through bulk and single-cell RNA sequencing integration.; Authors - Rui Han
human	WB	Cancer Biol Ther; LCP1 promotes ovarian cancer cell resistance to olaparib by activating the JAK2/STAT3 signalling pathway; Authors - Minxue Gai
human,mouse	WB,IHC	Cell Signal; Targeting LINC02613 to inhibit oral squamous cell carcinoma metastasis and progression via the rehabilitation of LCP1 ubiquitination.; Authors - Qiming Jiang