Tested Applications
| Positive WB detected in | HeLa cells, DU 145 cells, mouse heart tissue, rat heart tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human kidney tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14824-1-AP targets LDHB in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, bovine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6605 Product name: Recombinant human LDHB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-334 aa of BC002362 Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL Predict reactive species |
| Full Name | lactate dehydrogenase B |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC002362 |
| Gene Symbol | LDHB |
| Gene ID (NCBI) | 3945 |
| RRID | AB_2134953 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07195 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LDHB, also named as LDH-H and NY-REN-46, belongs to the LDH/MDH superfamily. And LDH family. It is an enzyme which catalyzes the reversible conversion of pyruvate and NADH to lactate and NAD+ in the glycolytic pathway. LDH comprises LDHA and LDHB, two subunits that are encoded by independent genes. In muscle or liver, most of the LDH is composed of four LDHA subunits, and preferably catalyzes the reduction of pyruvate to lactate. In heart and brain, LDH is mainly composed of four LDHB subunits, and predominantly catalyzes the oxidation of lactate to pyruvate. In other tissues, LDH is composed of both LDHA and LDHB. (PMID: 26269128, 31804482)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LDHB antibody 14824-1-AP | Download protocol |
| IHC protocol for LDHB antibody 14824-1-AP | Download protocol |
| IP protocol for LDHB antibody 14824-1-AP | Download protocol |
| WB protocol for LDHB antibody 14824-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LDHB polyclonal antibody (Cat# 14824-1-AP) has accumulated 112 citations across over 70 journals, including Nature Communications, Cell Metabolism, Nature Neuroscience, Cell Reports, Science Advances, Nature Methods, Cancer Research, and Cell Death & Disease. Research fields span cancer biology (glycolysis, Warburg effect, chemoresistance), histone lactylation and epigenetics, neuroscience, cardiology, immunology, hepatology, fibrosis, reproductive biology, and diabetes.
| Species | Application | Title |
|---|---|---|
J Hematol Oncol The PIK3CA E542K and E545K mutations promote glycolysis and proliferation via induction of the β-catenin/SIRT3 signaling pathway in cervical cancer. | ||
J Hepatol Nucleolin lactylation contributes to intrahepatic cholangiocarcinoma pathogenesis via RNA splicing regulation of MADD
| ||
Cell Metab The diapause-like colorectal cancer cells induced by SMC4 attenuation are characterized by low proliferation and chemotherapy insensitivity | ||
Cell Metab Astrocytic LRP1 enables mitochondria transfer to neurons and mitigates brain ischemic stroke by suppressing ARF1 lactylation | ||
Nat Methods A large-scale targeted proteomics assay resource based on an in vitro human proteome. | ||
Reviews
What customers say
Both reviews rate the product 5 stars. One user found it works well for immunofluorescence on FFPE human breast and kidney tissue at 1:100 overnight at 4°C, producing the expected staining pattern. Another user reported excellent Western Blot performance on BxPC3 cells at 1:1000, noting the LDHB band is very strong and clear. Overall, customers are highly satisfied with the antibody's specificity and signal quality across applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Maxence (Verified Customer) (08-28-2026) | This LDHB works well in IF-P. The staining is what we expect in human breast and kidney tissues. The IF staining was performed on FFPE human tissue slides with Dako antigen retrival pH9. Primary incubation was performed at 1:100 overnight (16h) at 4°C. Secondary incubation was performed with Goat anti-Rabbit at 1:2000 for 2h at RT. Image were taken with a Leica THUNDER at 10x and 20x magnification.
 |
Xiaoping (Verified Customer) (03-03-2026) | good to use in WB. the LDHB band is very strong and clear. very good!
|
