• Featured Product
  • KD/KO Validated

LDHB Polyclonal antibody

LDHB Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 14824-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IP, ELISA

lactate dehydrogenase B, EC:1.1.1.27, LDHA, LDH H, LDH B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, DU 145 cells, mouse heart tissue, rat heart tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman kidney tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14824-1-AP targets LDHB in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, bovine, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6605

Product name: Recombinant human LDHB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-334 aa of BC002362

Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Predict reactive species
Full Name lactate dehydrogenase B
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC002362
Gene Symbol LDHB
Gene ID (NCBI) 3945
RRIDAB_2134953
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP07195
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LDHB, also named as LDH-H and NY-REN-46, belongs to the LDH/MDH superfamily. And LDH family. It is an enzyme which catalyzes the reversible conversion of pyruvate and NADH to lactate and NAD+ in the glycolytic pathway. LDH comprises LDHA and LDHB, two subunits that are encoded by independent genes. In muscle or liver, most of the LDH is composed of four LDHA subunits, and preferably catalyzes the reduction of pyruvate to lactate. In heart and brain, LDH is mainly composed of four LDHB subunits, and predominantly catalyzes the oxidation of lactate to pyruvate. In other tissues, LDH is composed of both LDHA and LDHB. (PMID: 26269128, 31804482)

Protocols

Product Specific Protocols
IF protocol for LDHB antibody 14824-1-APDownload protocol
IHC protocol for LDHB antibody 14824-1-APDownload protocol
IP protocol for LDHB antibody 14824-1-APDownload protocol
WB protocol for LDHB antibody 14824-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Methods

A large-scale targeted proteomics assay resource based on an in vitro human proteome.

Authors - Masaki Matsumoto
mouseIF

Nat Neurosci

A glycolytic shift in Schwann cells supports injured axons.

Authors - Elisabetta Babetto
humanWB

Nucleic Acids Res

Histone lactylation-boosted ALKBH3 potentiates tumor progression and diminished promyelocytic leukemia protein nuclear condensates by m1A demethylation of SP100A

Authors - Xiang Gu
mouseWB

Nat Commun

Enhancement of anaerobic glycolysis - a role of PGC-1α4 in resistance exercise.

Authors - Jin-Ho Koh
humanWB

Nat Commun

Interactome analysis reveals that lncRNA HULC promotes aerobic glycolysis through LDHA and PKM2.

Authors - Chunqing Wang
mouseWB

Nat Commun

LDHA-mediated ROS generation in chondrocytes is a potential therapeutic target for osteoarthritis.

Authors - Manoj Arra
Loading...
||
New chat Able
正在加载,请稍候...