LDHB Monoclonal antibody, PBS Only

• 

  WB analysis using 66425-1-Ig (same clone as 66425-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66425-1-Ig (LDHB antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 66425-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 66425-1-Ig (same clone as 66425-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 66425-1-Ig (LDHB antibody) at dilution of 1:32000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66425-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 66425-1-Ig (same clone as 66425-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 66425-1-Ig (LDHB antibody) at dilution of 1:32000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66425-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66425-1-Ig (same clone as 66425-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 66425-1-Ig (LDHB antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66425-1-PBS in a different storage buffer formulation.

LDHB Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66425-1-PBS

Clone No.5E9G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

lactate dehydrogenase B, 5E9G1, EC:1.1.1.27, LDH, LDH B

---

Product Information

66425-1-PBS targets LDHB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6605

  Product name: Recombinant human LDHB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-334 aa of BC002362

  Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

• Full Name: lactate dehydrogenase B
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC002362
• Gene Symbol: LDHB
• Gene ID (NCBI): 3945
• RRID: AB_2881796
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P07195
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LDHB, also named as LDH-H and NY-REN-46, belongs to the LDH/MDH superfamily. And LDH family. It is an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway.It is glycolytic enzymes and it is positively regulated by mTOR.