Tested Applications
| Positive WB detected in | HeLa cells, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
82724-1-RR targets LDLR in WB, IHC, IF/ICC, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag1236 Product name: Recombinant human LDLR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC014514 Sequence: MGPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQR Predict reactive species |
| Full Name | low density lipoprotein receptor |
| Calculated Molecular Weight | 95 kDa |
| Observed Molecular Weight | 100-160 kDa |
| GenBank Accession Number | BC014514 |
| Gene Symbol | LDLR |
| Gene ID (NCBI) | 3949 |
| ENSEMBL Gene ID | ENSG00000130164 |
| RRID | AB_3086519 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01130 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LDLR (low density lipoprotein receptor) is a member of the LDL receptor gene family and is involved in receptor-mediated endocytosis of specific ligands. The LDLR is a cell surface glycoprotein that scavenges LDL from the blood and regulates plasma LDL cholesterol. The cytoplasmic domain of the LDL receptor is necessary for the receptor to cluster in coated pits, which promotes the rapid endocytosis of bound LDL. The protein is highly glycosylated through N- and O-linkages and thus migrates at 100 to 160 kDa bands on SDS-PAGE.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LDLR antibody 82724-1-RR | Download protocol |
| IHC protocol for LDLR antibody 82724-1-RR | Download protocol |
| WB protocol for LDLR antibody 82724-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LDLR Recombinant monoclonal antibody (1O11), catalog number 82724-1-RR, has 9 citations published in journals including ACS Nano, Cell Reports in Medicine, Journal of Neuroinflammation, Phytomedicine, International Journal of Pharmaceutics, Investigative Ophthalmology & Visual Science, Food and Chemical Toxicology, Biological & Pharmaceutical Bulletin, and Diabetes, Obesity and Metabolism. Research fields span lipid metabolism, tumor-targeted nanomedicine, neuroinflammation, hyperlipidemia, mRNA-LNP stability, diabetic complications, nanoplastic toxicity, and GLP-1 receptor pharmacology.
| Species | Application | Title |
|---|---|---|
ACS Nano Role of Serum Stability and Lipoprotein Interactions in Lipid Structure-Tumor Accumulation Relationship | ||
Cell Rep Med Engineered oncolytic virus armed with anti-PCSK9 scFv boosts long-term CD8(+) T cell immunity via rewiring MHC-I antigen presentation. | ||
J Neuroinflammation APOE-mediated lipid transport prevents C1q-related synaptic loss after spinal cord injury via attenuating macrophage lipid stress. | ||
Phytomedicine Xia Ku Cao Paste restores intestinal microbiota homeostasis and improves hepatic metabolism disturbances to alleviate hyperlipidemia. | ||
Int J Pharm Recombinant ApoE3 corona plus sucrose vitrification endows mRNA-LNPs with Freeze-Thaw and -80 °C stability. | ||
Invest Ophthalmol Vis Sci Effects of Cholesterol Metabolism on Corneal Endothelial Dysfunction in Patients With Type 1 Diabetes |
Reviews
What customers say
One customer rated this antibody 5 stars after using it for immunofluorescence on HeLaM cells at a 1:250 dilution (Lot 23005951). They reported it worked very well, enabling clear colocalization with early endosomal markers. Overall, the feedback highlights reliable performance for IF applications with strong signal quality.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ioana (Verified Customer) (08-28-2025) | It worked very well for immunofluorescence, allowing colocalization with early endosomal markets.
|
