LECT2 Polyclonal antibody

• 

LECT2 Polyclonal Antibody for ELISA

Cat No. 18317-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

chm II, chm2, hLECT2, LECT 2, LECT2

---

Product Information

18317-1-AP targets LECT2 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13003

  Product name: Recombinant human LECT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-151 aa of BC093670

  Sequence: ICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYL

• Full Name: leukocyte cell-derived chemotaxin 2
• Calculated Molecular Weight: 151 aa, 16 kDa
• GenBank Accession Number: BC093670
• Gene Symbol: LECT2
• Gene ID (NCBI): 3950
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14960
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.