Leptin Recombinant monoclonal antibody, PBS Only

• 

Leptin Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84072-1-PBS

Clone No.240720B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

LEP, OB, Obese protein, Obesity factor, OBS

---

Product Information

84072-1-PBS targets Leptin in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0834

  Product name: Recombinant Human Leptin protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 22-167 aa of BC060830

  Sequence: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

• Full Name: leptin
• Calculated Molecular Weight: 167 aa, 19 kDa
• GenBank Accession Number: BC060830
• Gene Symbol: Leptin
• Gene ID (NCBI): 3952
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41159
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.