LETM2 Polyclonal antibody

• 

  IHC staining of human placenta using 17180-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 17180-1-AP (LETM2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 17180-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 17180-1-AP (LETM2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human small intestine using 17180-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 17180-1-AP (LETM2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human small intestine using 17180-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 17180-1-AP (LETM2 Antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

LETM2 Polyclonal Antibody for IHC, ELISA

Cat No. 17180-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

LETM2

---

Tested Applications

• Positive IHC detected in: human placenta tissue, human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IHC: See 2 publications below

Product Information

17180-1-AP targets LETM2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10900

  Product name: Recombinant human LETM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-277 aa of BC029541

  Sequence: MEEKQKKKMAVKLELAKFLQETMTEMARRNRAKMGDASTQLSSYVKQVQTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFTESKENMVDLAPQLKGTKDEDFIQPPPVTSSPITPSTPISLPKGPITSSEEPTLQAKSQMTAQNSKASSKGA

• Full Name: leucine zipper-EF-hand containing transmembrane protein 2
• Calculated Molecular Weight: 277 aa, 31 kDa
• GenBank Accession Number: BC029541
• Gene Symbol: LETM2
• Gene ID (NCBI): 137994
• RRID: AB_2571737
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2VYF4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Am J Hum Genet; Whole-Genome Sequencing Reveals Diverse Models of Structural Variations in Esophageal Squamous Cell Carcinoma.; Authors - Caixia Cheng ; KD Validated
human	WB	J Transl Med; Integrated multi-omics analysis and machine learning developed a prognostic model based on mitochondrial function in a large multicenter cohort for Gastric Cancer; Authors - Yimeng Ma
human	WB	J Mol Med (Berl); Hyper-SUMOylation of SMN induced by SENP2 deficiency decreases its stability and leads to spinal muscular atrophy-like pathology.; Authors - Yuhong Zhang
human	WB,IHC	Cancers (Basel); A LETM2-Regulated PI3K-Akt Signaling Axis Reveals a Prognostic and Therapeutic Target in Pancreatic Cancer; Authors - Shurui Zhou