LGALS3BP Monoclonal antibody

LGALS3BP Monoclonal Antibody for ELISA
Cat No. 60066-2-Ig
Clone No.3G4F11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

ELISA

90K, BTBD17B, Galectin 3 binding protein, LGALS3BP, M2BP, Mac 2 binding protein, MAC 2 BP, MAC2BP, Tumor associated antigen 90K

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60066-2-Ig targets LGALS3BP in ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0294

Product name: Recombinant human LGALS3BP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 6-221 aa of BC002403

Sequence: LFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITL

Predict reactive species
Full Name lectin, galactoside-binding, soluble, 3 binding protein
Calculated Molecular Weight 585 aa, 65 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC002403
Gene Symbol LGALS3BP
Gene ID (NCBI) 3959
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ08380
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP is a widely expressed, secreted galectin. It has been found elevated in the serum of patients with various types of breast, lung, colorectal, ovary, and endometrial cancer, and in those infected by the human immunodeficiency virus (HIV). High expression levels of LGALS3BP are associated with a shorter survival, the occurrence of metastasis or a reduced response to chemotherapy. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1. It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Immunoblotting showed that LGALS3BP is likely contained in breast milk, serum, semen, saliva, urine, and tears.

Loading...
||
New chat Able
正在加载,请稍候...