LGALS3BP Recombinant monoclonal antibody, PBS Only

LGALS3BP Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 85883-5-PBS
Clone No.250138C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

90K, BTBD17B, Galectin 3 binding protein, Galectin-3-binding protein, Lectin galactoside-binding soluble 3-binding protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85883-5-PBS targets LGALS3BP in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3302

Product name: Recombinant Human LGALS3BP protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 19-140 aa of NM_005567

Sequence: VNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELS

Predict reactive species
Full Name lectin, galactoside-binding, soluble, 3 binding protein
Calculated Molecular Weight585 aa, 65 kDa
Observed Molecular Weight97, 70 kDa
GenBank Accession NumberNM_005567
Gene Symbol LGALS3BP
Gene ID (NCBI) 3959
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08380
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-3-binding protein (LGALS3BP, also known as 90K or Mac-2 BP) is a secreted glycoprotein which binds galectin-3, galectin-1, beta1 integrins, collagens and fibronectin (PMID: 8034587; 8024581; 11146440; 9501082). It has been implicated in tumor metastatic processes, as well as in other cell adhesion and immune functions. Levels of LGALS3BP have been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV) (PMID: 7698018). Western analysis suggests that LGALS3BP is found in breast milk, semen, saliva, urine, and tears, in addition to serum (PMID: 8390986 ).

Loading...
||
New chat Able
正在加载,请稍候...