Galectin-4 Monoclonal antibody

• 

  WB analysis of HT-29 using 66686-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 66686-1-Ig (LGALS4,GAL4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human ileum using 66686-1-Ig

  human ileum tissue were subjected to SDS PAGE followed by western blot with 66686-1-Ig (LGALS4,GAL4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 66686-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66686-1-Ig (Galectin-4 antibody) at dilution of 1:5000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 66686-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66686-1-Ig (Galectin-4 antibody) at dilution of 1:5000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 66686-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66686-1-Ig (Galectin-4 antibody) at dilution of 1:5000 (under 4x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 66686-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66686-1-Ig (LGALS4,GAL4 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 66686-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66686-1-Ig (LGALS4,GAL4 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66686-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66686-1-Ig (LGALS4,GAL4 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66686-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66686-1-Ig (LGALS4,GAL4 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human colon cancer using 66686-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using Galectin-4 antibody (66686-1-Ig, Clone: 3C2G3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human colon cancer using 66686-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using Galectin-4 antibody (66686-1-Ig, Clone: 3C2G3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

Galectin-4 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66686-1-Ig

Clone No.3C2G3

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF-P, ELISA

Synonyms

3C2G3, Antigen NY CO 27, Antigen NY-CO-27, Gal 4, GAL4

---

Tested Applications

• Positive WB detected in: HT-29 cells, human ileum tissue
• Positive IHC detected in: human colon tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human colon cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:2000-1:5000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66686-1-Ig targets Galectin-4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4049

  Product name: Recombinant human LGALS4,GAL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-323 aa of BC034750

  Sequence: MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI

• Full Name: lectin, galactoside-binding, soluble, 4
• Calculated Molecular Weight: 323 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC034750
• Gene Symbol: Galectin-4
• Gene ID (NCBI): 3960
• RRID: AB_2882040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56470
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-4 contains two arbohydrate recognition domains (CRDs) and is expressed in the epithelium of oral mucosa, esophagus, and intestinal and colonic mucosa (PMID: 15546874; 15115909). Aberrant expression of galectin-4 has been reported in several cancers.