LGALS9/Galectin-9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LGALS9/Galectin-9 Polyclonal antibody, PBS Only (17938-1-PBS)

• 

  WB analysis using 17938-1-AP (same clone as 17938-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17938-1-AP (LGALS9/Galectin-9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17938-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 17938-1-AP (same clone as 17938-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 17938-1-AP (Galectin-9 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17938-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-937 using 17938-1-AP (same clone as 17938-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U-937 cells using LGALS9/Galectin-9 antibody (17938-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 17938-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LGALS9/Galectin-9 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17938-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Galectin 9, LGALS9, Ecalectin, Gal 9, Gal-9

---

Product Information

17938-1-PBS targets LGALS9/Galectin-9 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12209

  Product name: Recombinant human LGALS9, Galectin-9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-323 aa of BC110340

  Sequence: MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

• Full Name: lectin, galactoside-binding, soluble, 9
• Calculated Molecular Weight: 323 aa, 36 kDa
• Observed Molecular Weight: 34-40 kDa
• GenBank Accession Number: BC110340
• Gene Symbol: Galectin-9
• Gene ID (NCBI): 3965
• RRID: AB_2137233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00182
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The galectins, formerly known as S-type lectins, are a family of β-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-9 (LGALS9) is a tandem repeat-type member of the galectin family. It has three isoforms (named galectin-9L, galectin-9M, and galectin-9S): long type of 355 amino acids, medium type of 323 amino acids, and short type of 311 amino acids. Galectin-9 is ubiquitously expressed in a variety of tissues, including lymph nodes and spleen, and overexpressed in Hodgkin disease tissue. It is involved in chemoattraction, apoptosis, and the regulation of cell differentiation and has anti-allergic effects. It has been reported that galectin-9 is a ligand for Tim-3, through which galectin-9 can induce T-helper type 1 lymphocyte (Th1) death.