LGI2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LGI2 Polyclonal antibody, PBS Only (18044-1-PBS)

• 

  WB analysis using 18044-1-AP (same clone as 18044-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18044-1-AP (LGI2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18044-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 18044-1-AP (same clone as 18044-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 18044-1-AP (LGI2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18044-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 18044-1-AP (same clone as 18044-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18044-1-AP (LGI2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18044-1-PBS in a different storage buffer formulation.

LGI2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18044-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

18044-1-PBS targets LGI2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12680

  Product name: Recombinant human LGI2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 196-545 aa of BC101759

  Sequence: GPPEYQEKKLNDVTSFDYECTTTDFVVHQTLPYQSVSVDTFNSKNDVYVAIAQPSMENCMVLEWDHIEMNFRSYDNITGQSIVGCKAILIDDQVFVVVAQLFGGSHIYKYDESWTKFVKFQDIEVSRISKPNDIELFQIDDETFFVIADSSKAGLSTVYKWNSKGFYSYQSLHEWFRDTDAEFVDIDGKSHLILSSRSQVPIILQWNKSSKKFVPHGDIPNMEDVLAVKSFRMQNTLYLSLTRFIGDSRVMRWNSKQFVEIQALPSRGAMTLQPFSFKDNHYLALGSDYTFSQIYQWDKEKQLFKKFKEIYVQAPRSFTAVSTDRRDFFFASSFKGKTKIFEHIIVDLSL

• Full Name: leucine-rich repeat LGI family, member 2
• Calculated Molecular Weight: 545 aa, 62 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC101759
• Gene Symbol: LGI2
• Gene ID (NCBI): 55203
• RRID: AB_2134996
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N0V4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.