Tested Applications
| Positive WB detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21094-1-AP targets LHFPL4 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15349 Product name: Recombinant human LHFPL4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 197-247 aa of BC113964 Sequence: LGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP Predict reactive species |
| Full Name | lipoma HMGIC fusion partner-like 4 |
| Calculated Molecular Weight | 247 aa, 27 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC113964 |
| Gene Symbol | LHFPL4 |
| Gene ID (NCBI) | 375323 |
| RRID | AB_3669357 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q7Z7J7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LHFPL4, or Lipoma HMGIC Fusion Partner-Like 4, is a member of the tetraspanin superfamily of transmembrane proteins. LHFPL4 interacts tightly with GABAAR subunits and is selectively enriched at inhibitory synapses. It is important for GABAAR clustering both in vitro and in vivo, and it is required for surface clustering but not the trafficking of GABAARs (PMID: 28978485).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for LHFPL4 antibody 21094-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

