LHFPL5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LHFPL5 Polyclonal antibody, PBS Only (21058-1-PBS)

• 

  WB analysis using 21058-1-AP (same clone as 21058-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21058-1-AP (LHFPL5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21058-1-PBS in a different storage buffer formulation.

LHFPL5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21058-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21058-1-PBS targets LHFPL5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14663

  Product name: Recombinant human LHFPL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 66-124 aa of BC028630

  Sequence: SYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALGMFLIIGSIICFSLFFICNTA

• Full Name: lipoma HMGIC fusion partner-like 5
• Calculated Molecular Weight: 219 aa, 24 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC028630
• Gene Symbol: LHFPL5
• Gene ID (NCBI): 222662
• RRID: AB_3669355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAF8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LHFPL5 (lipoma HMGIC fusion partner-like 5), previously known as TMHS (tetraspan membrane protein of hair cell stereocilia), is necessary for proper MET channel function. LHFPL5 is a four transmembrane segment protein from the superfamily of tetraspan proteins that includes the claudin tight junction proteins, gap junction proteins, peripheral myelin proteins, and ion channel auxiliary subunits (PMID: 36781873).