LHX5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LHX5 Polyclonal antibody, PBS Only (21567-1-PBS)

• 

  WB analysis of HEK-293 using 21567-1-AP (same clone as 21567-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21567-1-AP (LHX5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21567-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 21567-1-AP (same clone as 21567-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21567-1-AP (LHX5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21567-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 21567-1-AP (same clone as 21567-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 21567-1-AP (LHX5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21567-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 21567-1-AP (same clone as 21567-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21567-1-AP (LHX5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21567-1-PBS in a different storage buffer formulation.

LHX5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21567-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21567-1-PBS targets LHX5 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16081

  Product name: Recombinant human LHX5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 260-402 aa of BC109230

  Sequence: PLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDTPSPEPGLPGTLHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW

• Full Name: LIM homeobox 5
• Calculated Molecular Weight: 402 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC109230
• Gene Symbol: LHX5
• Gene ID (NCBI): 64211
• RRID: AB_10734588
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2C1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.