DNA Ligase I Polyclonal antibody

• 

  WB analysis using 18051-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18051-1-AP (DNA Ligase I antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 18051-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 18051-1-AP (DNA Ligase I antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 18051-1-AP

  IP result of anti-DNA Ligase I (IP:18051-1-AP, 4ug; Detection:18051-1-AP 1:500) with HepG2 cells lysate 3200ug.

• 

  IHC staining of human spleen using 18051-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 18051-1-AP (DNA Ligase I antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human spleen using 18051-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 18051-1-AP (DNA Ligase I antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human placenta using 18051-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 18051-1-AP (DNA Ligase I antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human placenta using 18051-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 18051-1-AP (DNA Ligase I antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human testis using 18051-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 18051-1-AP (DNA Ligase I antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 18051-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 18051-1-AP (DNA Ligase I antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human brain using 18051-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 18051-1-AP (DNA Ligase I antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 18051-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 18051-1-AP (DNA Ligase I antibody) at dilution of 1:100 (under 40x lens).

• Featured Product
• KD/KO Validated

DNA Ligase I Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 18051-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, CoIP, ELISA

Synonyms

DNA ligase 1, DNA Ligase I, LIG1, ligase I, DNA, ATP dependent

---

Tested Applications

• Positive WB detected in: HeLa cells, A431 cells, Jurkat cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human spleen tissue, human brain tissue, human placenta tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 15 publications below
• IHC: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

18051-1-AP targets DNA Ligase I in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12508

  Product name: Recombinant human LIG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 670-919 aa of BC108318

  Sequence: LVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY

• Full Name: ligase I, DNA, ATP-dependent
• Calculated Molecular Weight: 919 aa, 102 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC108318
• Gene Symbol: LIG1
• Gene ID (NCBI): 3978
• RRID: AB_2265726
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18858
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNA ligase I (LIG1) joins DNA strand breaks during DNA replication and repair transactions and contributes to genome integrity. 18051-1-AP is raised agains the C-terminal 670-919 aa residues of the human DNA ligase 1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; eccDNAs are apoptotic products with high innate immunostimulatory activity; Authors - Yuangao Wang
human	WB,IHC	Mol Cancer; hsa_circ_0007919 induces LIG1 transcription by binding to FOXA1/TET1 to enhance the DNA damage response and promote gemcitabine resistance in pancreatic ductal adenocarcinoma; Authors - Lei Xu
mouse	WB	Nat Commun; Cas9-induced large deletions and small indels are controlled in a convergent fashion.; Authors - Michael Kosicki
human	WB,IP	J Clin Invest; Biallelic mutations in DNA ligase 1 underlie a spectrum of immune deficiencies.; Authors - Patrick Maffucci ; KO Validated
rat	WB	Proc Natl Acad Sci U S A; Redundant function of DNA ligase 1 and 3 in alternative end-joining during immunoglobulin class switch recombination.; Authors - Shahnaz Masani ; KO Validated
mouse	WB	Proc Natl Acad Sci U S A; Ligase I and ligase III mediate the DNA double-strand break ligation in alternative end-joining.; Authors - Guangqing Lu ; KO Validated