LIG4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LIG4 Polyclonal antibody (12695-1-AP)

• Featured Product
• KD/KO Validated

LIG4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12695-1-AP Copied!

Publications (32)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

DNA ligase 4, DNA ligase IV, LIG4, ligase IV, DNA, ATP dependent

• 

  WB analysis of mouse testis using 12695-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12695-1-AP (LIG4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 12695-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12695-1-AP (LIG4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 12695-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12695-1-AP (LIG4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12695-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12695-1-AP (LIG4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat testis using 12695-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 12695-1-AP (LIG4 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 12695-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 12695-1-AP (LIG4 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 12695-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis slide using 12695-1-AP (LIG4 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 12695-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 12695-1-AP (LIG4 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LIG4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, mouse liver tissue, HepG2 cells, HeLa cells, rat testis tissue
• Positive IHC detected in: human prostate cancer tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12695-1-AP targets LIG4 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3385

  Product name: Recombinant human LIG4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 606-911 aa of BC037491

  Sequence: ASGKLASKHLYIGGDDEPQEKKRKAAPKMKKVIGIIEHLKAPNLTNVNKISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI

• Full Name: ligase IV, DNA, ATP-dependent
• Calculated Molecular Weight: 911 aa, 104 kDa
• Observed Molecular Weight: 100-104 kDa
• GenBank Accession Number: BC037491
• Gene Symbol: LIG4
• Gene ID (NCBI): 3981
• RRID: AB_2136253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49917
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Two major pathways, homologous recombination (HR) and nonhomologous end joining (NHEJ), counteract one of themost toxic lesions, the DSB. The core protein complex mediating NHEJ in mammals includes DNA ligase IV (Lig4). Lig4 belongs to an ATP-dependent DNA ligase family, and joins single-strand brdownloadeaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. The complex Lig4-XRCC4 is responsible for the NHEJ ligation step, and XRCC4 enhances the joining activity of Lig4.

Publications

What published studies show

The LIG4 Polyclonal antibody (catalog #12695-1-AP) has 32 citations. These appear in journals including Science, Cell Host & Microbe, Cancer Research, Nature Communications, Nucleic Acids Research, Biomaterials, Cell Death & Differentiation, Oncogene, British Journal of Cancer, Cells, iScience, and PLoS One. Research fields center on DNA repair—particularly non-homologous end joining (NHEJ)—alongside DNA damage response, radiation sensitivity, and cancer biology, with applications in glioblastoma, colorectal, lung, and breast cancers. Most studies used Western blot, with some immunofluorescence and co-immunoprecipitation.

Automatically generated from the 32 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Science; Different DNA repair pathways support intact or truncated insertions by R2 retrotransposon protein.; Authors - Jeremy J R Mcintyre
human	WB	Cell Host Microbe; Cellular DNA ligase I is recruited to cytoplasmic vaccinia virus factories and masks the role of the vaccinia ligase in viral DNA replication.; Authors - Paran Nir N ; KD Validated
human	WB	Cancer Res; Inhibition of ATM Induces Hypersensitivity to Proton Irradiation by Upregulating Toxic End Joining.; Authors - Qin Zhou
human	WB	Nat Commun; Reciprocal regulation of RIG-I and XRCC4 connects DNA repair with RIG-I immune signaling.; Authors - Guijie Guo
human	WB	Nat Commun; Elevated nonhomologous end-joining by AATF enables efficient DNA damage repair and therapeutic resistance in glioblastoma; Authors - Lanjuan Mi
mouse	WB	Nat Commun; Rap1 regulates hematopoietic stem cell survival and affects oncogenesis and response to chemotherapy.; Authors - Ekta Khattar