Filter: AllWB

WB analysis using 30285-1-AP (same clone as 30285-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30285-1-AP (LILRA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30285-1-PBS in a different storage buffer formulation.

LILRA2 Polyclonal antibody, PBS Only

Name: LILRA2 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 30285-1-PBS

LILRA2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30285-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

30285-1-PBS targets LILRA2 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag32652 Product name: Recombinant human LILRA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 60-110 aa of BC017412 Sequence: LYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSD Predict reactive species
Full Name	leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2
Calculated Molecular Weight	466 aa, 51 kDa
Observed Molecular Weight	69 kDa
GenBank Accession Number	BC017412
Gene Symbol	LILRA2
Gene ID (NCBI)	11027
RRID	AB_2935537
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8N149
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™