LILRA5/CD85f Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85984-1-RR (same clone as 85984-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85984-1-RR (LILRA5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85984-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85984-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85984-1-RR against Human LILRA5/CD85f were performed. The affinity constant is below 1 pM.

LILRA5/CD85f Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85984-1-PBS

Clone No.250298B3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

LILRA5, CD85, CD85 antigen-like family member F, CD85f, ILT 11

---

Product Information

85984-1-PBS targets LILRA5/CD85f in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2737

  Product name: Recombinant Human LILRA5/CD85f protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 42-268 aa of NM_021250.4

  Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

• Full Name: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_021250.4
• Gene Symbol: LILRA5
• Gene ID (NCBI): 353514
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: A6NI73-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LILRA5, also named as CD85f, ILT11, LILRB7 or LIR9, is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is a group of immune inhibitory and stimulatory receptors (PMID: 15304001). There are two membrane-bound and two soluble forms of LILRA5. The transmembrane LILRA5 contains a short cytoplasmic domain and a charged arginine residue within the transmembrane region (PMID: 19009525). It is mostly expressed in myeloid cells, including monocytes and neutrophils (PMID: 12393390). LILRA5 may play a role in triggering innate immune responses. It does not function in class I MHC antigens recognition (PMID: 16675463).