Anti-Human LILRB2/CD85d Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human LILRB2/CD85d Rabbit Recombinant Antibody (98488-3-RR)

LILRB2/CD85d Uni-rAb^® Recombinant Antibody for FC

Cat No. 98488-3-RR Copied!

Clone No. 250299A6

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

LILRB2, CD85 antigen-like family member D, CD85d, ILT 4, ILT4

• 

  FC experiment of human PBMCs using 98488-3-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human LILRB2/CD85d Rabbit RecAb (98488-3-RR, Clone:250299A6) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using 98488-3-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human LILRB2/CD85d Rabbit RecAb (98488-3-RR, Clone: 250299A6) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LILRB2/CD85d in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98488-3-RR targets LILRB2/CD85d in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2839

  Product name: Recombinant Human LILRB2/CD85d protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-458 aa of NM_005874.4

  Sequence: QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRH

• Full Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
• Calculated Molecular Weight: 65 kDa
• GenBank Accession Number: NM_005874.4
• Gene Symbol: LILRB2
• Gene ID (NCBI): 10288
• RRID: AB_3746118
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N423-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

LILRB2 (Leukocyte immunoglobulin-like receptor subfamily B member 2), also known as ILT4, CD85d or MIR10, is a type I transmembrane glycoprotein that contains four extracellular immunoglobulin domains, a transmembrane domain, and three cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs) (PMID: 33928233). LILRB2 is mainly expressed in immunocytes including monocytes, macrophages, and dendritic cells, and transduces negative signals by its association with SHP-1 phosphatase via the ITIMs (PMID: 35717259). LILRB2 can interact with various ligands such as HLA-A, HLA-B, HLA-C, HLA-G, HLA-F, CD1c, CD1d, angiopoietin-like proteins (ANGPTLs), and SEMA4A.