Use Able AI chat for product recommendations

LILRB3 Polyclonal antibody, PBS Only

LILRB3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18260-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

18260-1-PBS targets LILRB3 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13110

Product name: Recombinant human LILRB3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 18-401 aa of BC112198

Sequence: RTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYRLDKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVNPSHRWRFTCYYYYMNTPQVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYS

Predict reactive species
Full Name leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3
Calculated Molecular Weight 631 aa, 69 kDa
Observed Molecular Weight80-90 kDa
GenBank Accession NumberBC112198
Gene Symbol LILRB3
Gene ID (NCBI) 11025
RRIDAB_2918060
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75022
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The leukocyte immunoglobulin-like receptors (LIRs, also known as ILTs, CD85, and LILRs) comprise a family of related immunoregulatory receptors encoded within the leukocyte receptor cluster (LRC) at chromosomal region 19q13.4 (PMID: 11491530). LIRs are transmembrane proteins containing either two or four extracellular immunoglobulin domains, and have diverse functions, including the regulation of inflammation, immune tolerance, cell differentiation and nervous system plasticity (PMID: 16406677; 26040207). LILRB3, also known as ILT-5 or CD85a, belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). LILRB3 is found on the surface of a variety of cell types including monocytes/macrophages, granulocytes, NK cells and some T cells. It binds to MHC class I molecules and transduces a negative signal that inhibits stimulation of an immune response. LILRB3 has been reported as a myeloid cell checkpoint that elicits profound immunomodulation (PMID: 32870822).

Loading...
||
New chat

Able

正在加载,请稍候...