LIMD2 Polyclonal antibody

• 

  WB analysis of U-937 using 15471-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 15471-1-AP (LIMD2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 15471-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 15471-1-AP (LIMD2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 15471-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 15471-1-AP (LIMD2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 15471-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 15471-1-AP (LIMD2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human ovary cancer using 15471-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 15471-1-AP (LIMD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 15471-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 15471-1-AP (LIMD2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 15471-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 15471-1-AP (LIMD2 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

LIMD2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15471-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

LIM domain containing 2, LIM domain-containing protein 2, SB143

---

Tested Applications

• Positive WB detected in: U-937 cells, Raji cells
• Positive IHC detected in: human ovary cancer tissue, human brain tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IF: See 1 publications below

Product Information

15471-1-AP targets LIMD2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7775

  Product name: Recombinant human LIMD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-127 aa of BC004400

  Sequence: MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEVDPGTKTA

• Full Name: LIM domain containing 2
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 16-20 kDa
• GenBank Accession Number: BC004400
• Gene Symbol: LIMD2
• Gene ID (NCBI): 80774
• RRID: AB_10859817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BT23
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Bioengineered; LIM domain-containing 2 (LIMD2) promotes the progress of ovarian cancer via the focal adhesion signaling pathway.; Authors - Lixin Chen
human	WB	Mol Biol Rep; Knockdown of LIMD2 inhibits the progression of ovarian carcinoma through ERK1/2 pathway; Authors - Haiyang Hu ; KD Validated