LIMK2 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HepG2 using 82977-1-RR (same clone as 82977-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using LIMK2 antibody (82977-1-RR, Clone: 230283D10 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 82977-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 82977-1-RR (same clone as 82977-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug LIMK2 Recombinant antibody (82977-1-RR, Clone:230283D10) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 82977-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82977-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82977-1-RR against Human LIMK2 were performed. The affinity constant is 4.03 nM.

LIMK2 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 82977-1-PBS

Clone No.230283D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

LIMK-2, LIMK 2, LIM domain kinase 2, EC:2.7.11.1, 230283D10

---

Product Information

82977-1-PBS targets LIMK2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3011

  Product name: Recombinant human LIMK2 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 379-686 aa of BC013051

  Sequence: KLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRAPPGAAGEGPGCADDEGPVRRQGKVTIKYDPKELRKHLNLEEWILEQLTRLYDCQEEEISELEIDVDELLDMESDDAWASRVKELLVDCYKPTEAFISGLLDKIRAMQKLSTPQKK

• Full Name: LIM domain kinase 2
• Calculated Molecular Weight: 686 aa, 78 kDa
• GenBank Accession Number: BC013051
• Gene Symbol: LIMK2
• Gene ID (NCBI): 3985
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P53671
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.