LINGO3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LINGO3 Polyclonal antibody (32267-1-AP)

• 

  WB analysis using 32267-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32267-1-AP (LINGO3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

LINGO3 Polyclonal Antibody for WB, ELISA

Cat No. 32267-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

LERN2, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3, Leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 6B, LRRN6B

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-1 cells, U-251 cells, U-87 MG cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32267-1-AP targets LINGO3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37289

  Product name: Recombinant human LINGO3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 360-530 aa of NM_001101391

  Sequence: LLWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCRAEGEPAPTVAWVTPQHRPVTATSAGRARVLPGGTLEIQDARPQDSGTYTCVASNAGGNDTYFATLTVRPEPAANRTPGEAHNETLAALRAPLDLTTILVS

• Full Name: leucine rich repeat and Ig domain containing 3
• Calculated Molecular Weight: 64kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: NM_001101391
• Gene Symbol: LINGO3
• Gene ID (NCBI): 645191
• RRID: AB_3742558
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0C6S8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LINGO3 represents a previously unrecognized factor that promotes mucosal wound healing. It partially transduces the repair signals of TFF2, especially through the MAPK signaling cascade, and facilitates epithelial regeneration by preserving the intestinal stem cell microenvironment and maintaining Lgr5 expression (PMID: 33941035).