LIPI Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LIPI Polyclonal antibody, PBS Only (24300-1-PBS)

• 

  WB analysis of A549 using 24300-1-AP (same clone as 24300-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 24300-1-AP (LIPI Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24300-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 24300-1-AP (same clone as 24300-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 24300-1-AP (LIPI Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24300-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 24300-1-AP (same clone as 24300-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24300-1-AP (LIPI antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 24300-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 24300-1-AP (same clone as 24300-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24300-1-AP (LIPI antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 24300-1-PBS in a different storage buffer formulation.

LIPI Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24300-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

24300-1-PBS targets LIPI in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19024

  Product name: Recombinant human LIPI protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 264-481 aa of BC148691

  Sequence: FSGIQFIKCNHQRAVHLFMASLETNCNFISFPCRSYKDYKTSLCVDCDCFKEKSCPRLGYQAKLFKGVLKERMEGRPLRTTVFLDTSGTYPFCTYYFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKILAQFYNDFVNISSIGLTYFQSSNLQCSTCTYKIQRLMLKSLTYPERPPLCRYNIVLKDREEVFLNPNTCTPKNT

• Full Name: lipase, member I
• Calculated Molecular Weight: 460 aa, 55 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC148691
• Gene Symbol: LIPI
• Gene ID (NCBI): 149998
• RRID: AB_2879483
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6XZB0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.