ERGIC-53 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ERGIC-53 Polyclonal antibody (13364-1-AP)

• Featured Product
• KD/KO Validated

ERGIC-53 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13364-1-AP Copied!

Publications (37)

Reviews (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

LMAN1, ERGIC 53, ER-Golgi intermediate compartment 53 kDa protein, F5F8D, FMFD1

• 

  WB analysis using 13364-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13364-1-AP (ERGIC-53 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 13364-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13364-1-AP (ERGIC-53 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 13364-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13364-1-AP (ERGIC-53 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 13364-1-AP

  IP result of anti-ERGIC-53 (IP:13364-1-AP, 4ug; Detection:13364-1-AP 1:400) with HepG2 cells lysate 1000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 13364-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13364-1-AP (ERGIC-53 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 13364-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13364-1-AP (ERGIC-53 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 13364-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13364-1-AP (ERGIC-53 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 13364-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13364-1-AP (ERGIC-53 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 13364-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using ERGIC-53 antibody (13364-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 13364-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using 13364-1-AP (ERGIC-53 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ERGIC-53 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue, human brain tissue, HeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells, mouse heart tissue, mouse spleen tissue, rat heart tissue, rat spleen tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13364-1-AP targets ERGIC-53 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4183

  Product name: Recombinant human LMAN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-401 aa of BC032330

  Sequence: GDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILR

• Full Name: lectin, mannose-binding, 1
• Calculated Molecular Weight: 510 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC032330
• Gene Symbol: ERGIC-53
• Gene ID (NCBI): 3998
• RRID: AB_2135994
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49257
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ERGIC-53 (also known as LMAN1 or MR60) is a membrane mannose-specific lectin that selectively transports its cargo proteins from ER to ER-Golgi intermediate compartment (ERGIC) and Golgi, functioning as a cargo transport receptor for glycoproteins (PMID: 24664723; 10559958). Mutations in ERGIC-53 cause combined deficiency of coagulation factors V and VIII (PMID: 9546392).

Publications

What published studies show

The ERGIC-53 Polyclonal antibody (Cat# 13364-1-AP) has 37 citations across journals including Nature Communications, Cell Metabolism, Nature Cell Biology, Nature Microbiology, Autophagy, EMBO Journal, EMBO Molecular Medicine, Advanced Science, mBio, Journal of Virology, and others. Research fields span ER-Golgi trafficking, lipid homeostasis, STING/cGAS innate immunity signaling, viral infections (SARS-CoV-2, SFTSV, influenza A, HIV-1), autophagy, coagulation factor secretion, and Golgi biology.

Automatically generated from the 37 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Metab; TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis.; Authors - Dong Huang
human	WB	Cell Metab; Receptor-Mediated ER Export of Lipoproteins Controls Lipid Homeostasis in Mice and Humans.; Authors - Xiao Wang
mouse	WB	Nat Cell Biol; Manganese regulation of COPII condensation controls circulating lipid homeostasis; Authors - Xiao Wang
		Nat Microbiol; Mapping in-cell protein contact sites reveals hijacking of paraspeckles during influenza A virus infection.; Authors - Iuliia Kotova
pig	IF	Autophagy; STING1 is essential for an RNA-virus triggered autophagy.; Authors - Rui Zhang
		Autophagy; Cytosolic DNA-induced CGAS-STING1-dependent autophagy promotes SFTSV and EV-71 replication.; Authors - Xiao-Lan Gu

Reviews

4.5 out of 5

2 verified customer reviews

What customers say

Both reviewers report positive results with this antibody. One user (4/5) used it at 1:500 dilution for Western Blot and Immunoprecipitation validation of Ergic in human brain tissue. Another user (5/5) confirmed that the antibody detects endogenous Ergic53 by Western Blot with a very clean band. Overall, customers find this antibody reliable and specific for detecting Ergic53 in both WB and IP applications.

Automatically generated from the 2 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

pitna (Verified Customer) (05-26-2021)

for Ergic Immunoprecipitation validation for human brain

• Applications: Western Blot, Immunoprecipitation
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: human brain

ERGIC-53 Antibody Western Blot,Immunoprecipitation validation (1:500 dilution) in human brain (Cat no:13364-1-AP)

Boyan (Verified Customer) (02-19-2020)

For WB, this antibody could detect endogenous Ergic53 with a very clean band.

• Applications: Western Blot,