LMBR1L Polyclonal antibody

• 

  WB analysis of mouse testis using 12154-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12154-1-AP (LMBR1L antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 12154-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12154-1-AP (LMBR1L antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat testis using 12154-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 12154-1-AP (LMBR1L antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 12154-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12154-1-AP (LMBR1L antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 12154-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 12154-1-AP (LMBR1L antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 12154-1-AP

  IP result of anti-LMBR1L (IP:12154-1-AP, 4ug; Detection:12154-1-AP 1:500) with HepG2 cells lysate 3200ug.

LMBR1L Polyclonal Antibody for WB, IP, ELISA

Cat No. 12154-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

KIAA1174, LIMR, LMBR1L, Protein LMBR1L

---

Tested Applications

• Positive WB detected in: mouse testis tissue, A549 cells, HepG2 cells, mouse liver tissue, rat testis tissue
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12154-1-AP targets LMBR1L in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2787

  Product name: Recombinant human LMBR1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 219-490 aa of BC015015

  Sequence: RMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQTQRVLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAIHILELLIDEAAMPRGMQGTSLGQVSFSKLGSFGAVIQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAAVRAELIRAFGLDRLPLPVSGFPQASRKTQHQ

• Full Name: limb region 1 homolog (mouse)-like
• Calculated Molecular Weight: 489 aa, 55 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC015015
• Gene Symbol: LMBR1L
• Gene ID (NCBI): 55716
• RRID: AB_2136130
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UX01
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LMBR1L, also known as LIMR (lipocalin-1-interacting membrane receptor), interacts with lipocalin-1 (Lcn-1), a lipocalin member produced by a number of secretoric glands and tissues and known to bind a variety of lipophilic compounds. LMBR1L is a 489-amino acid protein with a predicted molecular mass of 55 kD and 9 putative transmembrane helices. LMBR1L has been shown to mediate cellular uptake of LMBR1L, thus it is characterized as a endocytic receptor (PMID: 11287427; 12591932). Alternatively spliced transcript variants encoding different isoforms have been described.