LMCD1 Polyclonal antibody

• 

  WB analysis using 15175-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15175-1-AP (LMCD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

LMCD1 Polyclonal Antibody for WB, ELISA

Cat No. 15175-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Dyxin, LIM and cysteine-rich domains protein 1

---

Tested Applications

• Positive WB detected in: Calu-1 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15175-1-AP targets LMCD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7068

  Product name: Recombinant human LMCD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-365 aa of BC000646

  Sequence: MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

• Full Name: LIM and cysteine-rich domains 1
• Calculated Molecular Weight: 41 kDa
• GenBank Accession Number: BC000646
• Gene Symbol: LMCD1
• Gene ID (NCBI): 29995
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZU5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.